General Information

  • ID:  hor002483
  • Uniprot ID:  A1Z8X3
  • Protein name:  Proctolin
  • Gene name:  ana3
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  Rotatin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005515 protein binding
  • GO BP:  GO:0007098 centrosome cycle; GO:0007099 centriole replication; GO:0010457 centriole-centriole cohesion; GO:0032053 ciliary basal body organization; GO:0044782 cilium organization; GO:0098534 centriole assembly
  • GO CC:  GO:0005737 cytoplasm; GO:0005813 centrosome; GO:0005814 centriole; GO:0005856 cytoskeleton; GO:0036064 ciliary basal body; GO:0061823 ring centriole

Sequence Information

  • Sequence:  RYLPT
  • Length:  5(690-694)
  • Propeptide:  MSTKQSPALQLAEGQLTKLTSESEEIRMRALDQIETRFIRCLQLGEPIQFKPVLLLKQLIRWFGYTPPLVPDRVLAMIMELLRSEYAEAVIRKIPYERFKAELQKVRRVLHKQESKRVSELLDDMNLLLLEKYNIDRVTPSVSSLSSNDIPSQATESADSSSNQIYDNLKPEDYEPSWSHPCLDDVATMKSMIDLPRNSVELQLQLTELIIRMGDYPTEYFLQPPFVFLHLVQLQTMTDGSLIHVNRALIACLRL
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Participes in the structural integrity of both centrioles and basal bodies and in centriole cohesion (PubMed:19948479). Participates in the later stages of centriole assembly through the interaction with Rcd4 leading to the centriole to centrosome convers
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A1Z8X3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002483_AF2.pdbhor002483_ESM.pdb

Physical Information

Mass: 72028 Formula: C30H48N8O8
Absent amino acids: ACDEFGHIKMNQSVW Common amino acids: LPRTY
pI: 9.35 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 1
Hydrophobicity: -86 Boman Index: -1271
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 78
Instability Index: 3144 Extinction Coefficient cystines: 1490
Absorbance 280nm: 372.5

Literature

  • PubMed ID:  12846841
  • Title:  Characterization of a Functionally Expressed Dipeptidyl Aminopeptidase III From Drosophila Melanogaster